![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187169] (30 PDB entries) |
![]() | Domain d3kf4b_: 3kf4 B: [179322] automated match to d1opjb_ complexed with b90 |
PDB Entry: 3kf4 (more details), 1.9 Å
SCOPe Domain Sequences for d3kf4b_:
Sequence, based on SEQRES records: (download)
>d3kf4b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv yelmracwqwnpsdrpsfaeihqafetmfqess
>d3kf4b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktltmeveeflkeaavmk eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel mracwqwnpsdrpsfaeihqafetmfqess
Timeline for d3kf4b_: