Lineage for d3kf4b_ (3kf4 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2546088Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)
  8. 2546131Domain d3kf4b_: 3kf4 B: [179322]
    automated match to d1opjb_
    complexed with b90

Details for d3kf4b_

PDB Entry: 3kf4 (more details), 1.9 Å

PDB Description: structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template
PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3kf4b_:

Sequence, based on SEQRES records: (download)

>d3kf4b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqess

Sequence, based on observed residues (ATOM records): (download)

>d3kf4b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktltmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqess

SCOPe Domain Coordinates for d3kf4b_:

Click to download the PDB-style file with coordinates for d3kf4b_.
(The format of our PDB-style files is described here.)

Timeline for d3kf4b_: