![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.5: PfkB-like kinase [82515] (3 proteins) includes a variety of carbohydrate and pyrimidine kinases |
![]() | Protein automated matches [190479] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187406] (10 PDB entries) |
![]() | Domain d3keub_: 3keu B: [179316] automated match to d1rfua_ complexed with atp, mg, mpd, na, plp, so4 |
PDB Entry: 3keu (more details), 2.1 Å
SCOPe Domain Sequences for d3keub_:
Sequence, based on SEQRES records: (download)
>d3keub_ c.72.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdelq elyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdge gsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdtv vitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamlla wthkhpnnlkvacektvstlhhvlqrtiqcakaqagegvrpspmqlelrmvqskrdiedp eivvqatvl
>d3keub_ c.72.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ecrvlsiqshvirgyvgnraatfplqvlgfeidavnsvqfsnhtgyahwkgqvlnsdelq elyeglrlnnmnkydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvlgdkwdge gsmyvpedllpvykekvvpladiitpnqfeaellsgrkihsqeealrvmdmlhsmgpdtv vitssdlpspqgsnylivlgsqrrrnpagsvvmerirmdirkvdavfvgtgdlfaamlla wthkhpnnlkvacektvstlhhvlqrtiqcakaqarpspmqlelrmvqskrdiedpeivv qatvl
Timeline for d3keub_: