![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
![]() | Protein D-dopachrome tautomerase [55344] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [267760] (1 PDB entry) |
![]() | Domain d3kerd_: 3ker D: [179314] automated match to d1dpta_ complexed with cl, na, rw1 |
PDB Entry: 3ker (more details), 2.78 Å
SCOPe Domain Sequences for d3kerd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kerd_ d.80.1.3 (D:) D-dopachrome tautomerase {Mouse (Mus musculus) [TaxId: 10090]} pfveletnlpasripaglenrlcaatatildkpedrvsvtirpgmtllmnkstepcahll vssigvvgtaeqnrthsasffkflteelsldqdrivirffpleawqigkkgtvmtfl
Timeline for d3kerd_: