![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.59: PAH2 domain [47761] (1 superfamily) 4 helices; open up-and-down bundle; binds alpha-helical peptides |
![]() | Superfamily a.59.1: PAH2 domain [47762] (1 family) ![]() |
![]() | Family a.59.1.1: PAH2 domain [47763] (3 proteins) |
![]() | Protein Sin3A [47766] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47767] (5 PDB entries) Uniprot Q96ST3 295-383 |
![]() | Domain d1g1eb_: 1g1e B: [17931] complex with Mad1 peptide; chain A |
PDB Entry: 1g1e (more details)
SCOPe Domain Sequences for d1g1eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1eb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]} slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt eqevyaqvarlfknqedllsefgqflpda
Timeline for d1g1eb_: