SCOPe 2.08: Domain d1g1eb_: 1g1e B:

Lineage for d1g1eb_ (1g1e B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.59: PAH2 domain [47761] (1 superfamily)
   4 helices; open up-and-down bundle; binds alpha-helical peptides

4. Superfamily a.59.1: PAH2 domain [47762] (1 family)

5. Family a.59.1.1: PAH2 domain [47763] (3 proteins)

6. Protein Sin3A [47766] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47767] (5 PDB entries)
   Uniprot Q96ST3 295-383

8. Domain d1g1eb_: 1g1e B: [17931]
   complex with Mad1 peptide; chain A

Details for d1g1eb_

PDB Entry: 1g1e

PDB Description: nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain

PDB Compounds: (B:) sin3a

SCOPe Domain Sequences for d1g1eb_:

Sequence; same for both SEQRES and ATOM records:

>d1g1eb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpda

Timeline for d1g1eb_:

• d1g1eb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1eb_ appears in SCOPe 2.07