Lineage for d3keia_ (3kei A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009352Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (15 PDB entries)
  8. 1009365Domain d3keia_: 3kei A: [179304]
    automated match to d1lbca_
    complexed with glu; mutant

Details for d3keia_

PDB Entry: 3kei (more details), 1.9 Å

PDB Description: crystal structure of the glua4 ligand-binding domain l651v mutant in complex with glutamate
PDB Compounds: (A:) Glutamate receptor 4

SCOPe Domain Sequences for d3keia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3keia_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tvvvttimespyvmykknhemfegndkyegycvdlaseiakhigikykiaivpdgkygar
dadtkiwngmvgelvygkaeiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlakqteiaygtvdsgstkeffrrskiavyekmwtymrsaepsvftrttaegvarvrks
kgkfafllestmneyteqrkpcdtmkvggnldskgygvatpkgsslrtpvnlavlklsea
gvldklknkwwydkgec

SCOPe Domain Coordinates for d3keia_:

Click to download the PDB-style file with coordinates for d3keia_.
(The format of our PDB-style files is described here.)

Timeline for d3keia_: