Lineage for d1e91a_ (1e91 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4255Fold a.59: PAH2 domain [47761] (1 superfamily)
  4. 4256Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 4257Family a.59.1.1: PAH2 domain [47763] (2 proteins)
  6. 4261Protein Sin3B [47764] (1 species)
  7. 4262Species Mouse (Mus musculus) [TaxId:10090] [47765] (1 PDB entry)
  8. 4263Domain d1e91a_: 1e91 A: [17930]

Details for d1e91a_

PDB Entry: 1e91 (more details)

PDB Description: structure of the complex of the mad1-sin3b interaction domains

SCOP Domain Sequences for d1e91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e91a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus)}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

SCOP Domain Coordinates for d1e91a_:

Click to download the PDB-style file with coordinates for d1e91a_.
(The format of our PDB-style files is described here.)

Timeline for d1e91a_: