Lineage for d1e91a_ (1e91 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715406Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 2715407Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 2715408Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 2715416Protein Sin3B [47764] (1 species)
  7. 2715417Species Mouse (Mus musculus) [TaxId:10090] [47765] (4 PDB entries)
  8. 2715418Domain d1e91a_: 1e91 A: [17930]
    complex with Mad1 peptide; chain B; CASP4

Details for d1e91a_

PDB Entry: 1e91 (more details)

PDB Description: structure of the complex of the mad1-sin3b interaction domains
PDB Compounds: (A:) paired amphipathic helix protein sin3b

SCOPe Domain Sequences for d1e91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e91a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus) [TaxId: 10090]}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

SCOPe Domain Coordinates for d1e91a_:

Click to download the PDB-style file with coordinates for d1e91a_.
(The format of our PDB-style files is described here.)

Timeline for d1e91a_: