Lineage for d3kdua_ (3kdu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008936Domain d3kdua_: 3kdu A: [179296]
    Other proteins in same PDB: d3kdub2
    automated match to d1i7ga_
    protein/DNA complex; complexed with nks

Details for d3kdua_

PDB Entry: 3kdu (more details), 2.07 Å

PDB Description: Crystal structure of peroxisome proliferator-activatedeceptor alpha (PPARalpha) complex with N-3-((2-(4-Chlorophenyl)-5-methyl-1,3-oxazol-4-yl)methoxy)benzyl)-N-((4-methylphenoxy)carbonyl)glycine
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d3kdua_:

Sequence, based on SEQRES records: (download)

>d3kdua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
setadlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvak
lvangiqnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeai
famlssvmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdisl
fvaaiiccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlv
tehaqlvqiikktesdaalhpllqeiyrdmy

Sequence, based on observed residues (ATOM records): (download)

>d3kdua_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
setadlkslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvai
qnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlss
vmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaii
ccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaql
vqiikktesdaalhpllqeiyrdmy

SCOPe Domain Coordinates for d3kdua_:

Click to download the PDB-style file with coordinates for d3kdua_.
(The format of our PDB-style files is described here.)

Timeline for d3kdua_: