SCOPe 2.05: Domain d1bc5a1: 1bc5 A:16-91

Lineage for d1bc5a1 (1bc5 A:16-91)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.58: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47756] (1 superfamily)
   4 helices; an orthogonal array

4. Superfamily a.58.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47757] (1 family)

5. Family a.58.1.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47758] (1 protein)

6. Protein Chemotaxis receptor methyltransferase CheR, N-terminal domain [47759] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [47760] (2 PDB entries)

8. Domain d1bc5a1: 1bc5 A:16-91 [17929]
   Other proteins in same PDB: d1bc5a2
   complexed with co, sah

Details for d1bc5a1

PDB Entry: 1bc5, 2.2 Å

PDB Description: chemotaxis receptor recognition by protein methyltransferase cher

PDB Compounds: (A:) chemotaxis receptor methyltransferase

SCOPe Domain Sequences for d1bc5a1:

Sequence; same for both SEQRES and ATOM records:

>d1bc5a1 a.58.1.1 (A:16-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmlea
nqnsaewqafinaltt

Timeline for d1bc5a1:

• d1bc5a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bc5a1 appears in SCOPe 2.04
  
• d1bc5a1 appears in SCOPe 2.06
  
• d1bc5a1 appears in the current release, SCOPe 2.08