Class a: All alpha proteins [46456] (286 folds) |
Fold a.58: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47756] (1 superfamily) 4 helices; an orthogonal array |
Superfamily a.58.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47757] (1 family) |
Family a.58.1.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47758] (1 protein) |
Protein Chemotaxis receptor methyltransferase CheR, N-terminal domain [47759] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [47760] (2 PDB entries) |
Domain d1bc5a1: 1bc5 A:16-91 [17929] Other proteins in same PDB: d1bc5a2 complexed with co, sah |
PDB Entry: 1bc5 (more details), 2.2 Å
SCOPe Domain Sequences for d1bc5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc5a1 a.58.1.1 (A:16-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmlea nqnsaewqafinaltt
Timeline for d1bc5a1: