Lineage for d1bc5a1 (1bc5 A:16-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715399Fold a.58: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47756] (1 superfamily)
    4 helices; an orthogonal array
  4. 2715400Superfamily a.58.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47757] (1 family) (S)
  5. 2715401Family a.58.1.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47758] (1 protein)
  6. 2715402Protein Chemotaxis receptor methyltransferase CheR, N-terminal domain [47759] (1 species)
  7. 2715403Species Salmonella typhimurium [TaxId:90371] [47760] (2 PDB entries)
  8. 2715405Domain d1bc5a1: 1bc5 A:16-91 [17929]
    Other proteins in same PDB: d1bc5a2
    complexed with co, sah

Details for d1bc5a1

PDB Entry: 1bc5 (more details), 2.2 Å

PDB Description: chemotaxis receptor recognition by protein methyltransferase cher
PDB Compounds: (A:) chemotaxis receptor methyltransferase

SCOPe Domain Sequences for d1bc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc5a1 a.58.1.1 (A:16-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgrylsmlea
nqnsaewqafinaltt

SCOPe Domain Coordinates for d1bc5a1:

Click to download the PDB-style file with coordinates for d1bc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1bc5a1: