SCOPe 2.06: Domain d3kcta_: 3kct A:

Lineage for d3kcta_ (3kct A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)

8. Domain d3kcta_: 3kct A: [179280]
   automated match to d1g7ka_

Details for d3kcta_

PDB Entry: 3kct, 1.65 Å

PDB Description: crystal structure of pamcherry1 in the photoactivated state

PDB Compounds: (A:) PAmCherry1 protein

SCOPe Domain Sequences for d3kcta_:

Sequence; same for both SEQRES and ATOM records:

>d3kcta_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvhmegsvnghvfeiegegegrpyegtqtaklkvtkggplpftwdilspqf
mygsnayvkhpadipdyfklsfpegfkwervmkfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgwealsermypedgalkgevkprvklkdgghydaevkttykakk
pvqlpgaynvnrklditshnedytiveqyeraegrhs

Timeline for d3kcta_:

• d3kcta_ first appeared in SCOPe 2.01
  
• d3kcta_ appears in SCOPe 2.05
  
• d3kcta_ appears in SCOPe 2.07
  
• d3kcta_ appears in the current release, SCOPe 2.08