SCOPe 2.08: Domain d1af7a1: 1af7 A:11-91

Lineage for d1af7a1 (1af7 A:11-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.58: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47756] (1 superfamily)
   4 helices; an orthogonal array

4. Superfamily a.58.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47757] (1 family)

5. Family a.58.1.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47758] (1 protein)

6. Protein Chemotaxis receptor methyltransferase CheR, N-terminal domain [47759] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [47760] (2 PDB entries)

8. Domain d1af7a1: 1af7 A:11-91 [17928]
   Other proteins in same PDB: d1af7a2
   complexed with sah

Details for d1af7a1

PDB Entry: 1af7, 2 Å

PDB Description: cher from salmonella typhimurium

PDB Compounds: (A:) chemotaxis receptor methyltransferase cher

SCOPe Domain Sequences for d1af7a1:

Sequence; same for both SEQRES and ATOM records:

>d1af7a1 a.58.1.1 (A:11-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
svllqmtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgryl
smleanqnsaewqafinaltt

Timeline for d1af7a1:

• d1af7a1 first appeared (with stable ids) in SCOP 1.55, called d1af7_1
  
• d1af7a1 appears in SCOPe 2.07