Lineage for d1af7a1 (1af7 A:11-91)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998589Fold a.58: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47756] (1 superfamily)
    4 helices; an orthogonal array
  4. 1998590Superfamily a.58.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47757] (1 family) (S)
  5. 1998591Family a.58.1.1: Chemotaxis receptor methyltransferase CheR, N-terminal domain [47758] (1 protein)
  6. 1998592Protein Chemotaxis receptor methyltransferase CheR, N-terminal domain [47759] (1 species)
  7. 1998593Species Salmonella typhimurium [TaxId:90371] [47760] (2 PDB entries)
  8. 1998594Domain d1af7a1: 1af7 A:11-91 [17928]
    Other proteins in same PDB: d1af7a2
    complexed with sah

Details for d1af7a1

PDB Entry: 1af7 (more details), 2 Å

PDB Description: cher from salmonella typhimurium
PDB Compounds: (A:) chemotaxis receptor methyltransferase cher

SCOPe Domain Sequences for d1af7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1af7a1 a.58.1.1 (A:11-91) Chemotaxis receptor methyltransferase CheR, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
svllqmtqrlalsdahfrricqliyqragivladhkrdmvynrlvrrlralglddfgryl
smleanqnsaewqafinaltt

SCOPe Domain Coordinates for d1af7a1:

Click to download the PDB-style file with coordinates for d1af7a1.
(The format of our PDB-style files is described here.)

Timeline for d1af7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1af7a2