SCOPe 2.05: Domain d3kcsa_: 3kcs A:

Lineage for d3kcsa_ (3kcs A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)

8. Domain d3kcsa_: 3kcs A: [179279]
   automated match to d1g7ka_

Details for d3kcsa_

PDB Entry: 3kcs, 1.5 Å

PDB Description: crystal structure of pamcherry1 in the dark state

PDB Compounds: (A:) PAmCherry1 protein

SCOPe Domain Sequences for d3kcsa_:

Sequence; same for both SEQRES and ATOM records:

>d3kcsa_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvhmegsvnghvfeiegegegrpyegtqtaklkvtkggplpftwdilspqf
mygsnayvkhpadipdyfklsfpegfkwervmkfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgwealsermypedgalkgevkprvklkdgghydaevkttykakk
pvqlpgaynvnrklditshnedytiveqyeraegrhs

Timeline for d3kcsa_:

• d3kcsa_ first appeared in SCOPe 2.01
  
• d3kcsa_ appears in SCOPe 2.04
  
• d3kcsa_ appears in SCOPe 2.06
  
• d3kcsa_ appears in the current release, SCOPe 2.08