Lineage for d3kcqc_ (3kcq C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892629Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2892630Protein automated matches [191110] (11 species)
    not a true protein
  7. 2892631Species Anaplasma phagocytophilum [TaxId:212042] [189161] (1 PDB entry)
  8. 2892634Domain d3kcqc_: 3kcq C: [179277]
    automated match to d1njsa_
    complexed with gol

Details for d3kcqc_

PDB Entry: 3kcq (more details), 2.2 Å

PDB Description: Crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum
PDB Compounds: (C:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3kcqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcqc_ c.65.1.0 (C:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
kelrvgvlisgrgsnlealakafsteessvviscvisnnaearglliaqsygiptfvvkr
kpldiehistvlrehdvdlvclagfmsilpekfvtdwhhkiinihpsllpsfkglnaqeq
aykagvkiagctlhyvyqeldagpiimqaavpvlredtaeslasrilaaehvcypkgvkl
iaqdkiklcddgtvqctgedelflfqenf

SCOPe Domain Coordinates for d3kcqc_:

Click to download the PDB-style file with coordinates for d3kcqc_.
(The format of our PDB-style files is described here.)

Timeline for d3kcqc_: