Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) |
Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
Protein automated matches [191110] (11 species) not a true protein |
Species Anaplasma phagocytophilum [TaxId:212042] [189161] (1 PDB entry) |
Domain d3kcqb_: 3kcq B: [179276] automated match to d1njsa_ complexed with gol |
PDB Entry: 3kcq (more details), 2.2 Å
SCOPe Domain Sequences for d3kcqb_:
Sequence, based on SEQRES records: (download)
>d3kcqb_ c.65.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} kelrvgvlisgrgsnlealakafsteessvviscvisnnaearglliaqsygiptfvvkr kpldiehistvlrehdvdlvclagfmsilpekfvtdwhhkiinihpsllpsfkglnaqeq aykagvkiagctlhyvyqeldagpiimqaavpvlredtaeslasrilaaehvcypkgvkl iaqdkiklcddgtvqctgedelflfqe
>d3kcqb_ c.65.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} kelrvgvlisgrgsnlealakafstsvviscvisnnaearglliaqsygiptfvvkrkpl diehistvlrehdvdlvclagfmsilpekfvtdwhhkiinihpsllpsfkglnaqeqayk agvkiagctlhyvyqeldagpiimqaavpvlredtaeslasrilaaehvcypkgvkliaq dkiklcddgtvqctgedelflfqe
Timeline for d3kcqb_: