SCOPe 2.01: Domain d3kcpb_: 3kcp B:

Lineage for d3kcpb_ (3kcp B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (5 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [189219] (1 PDB entry)

8. Domain d3kcpb_: 3kcp B: [179274]
   automated match to d2b59a1
   complexed with ca, cl

Details for d3kcpb_

PDB Entry: 3kcp, 1.94 Å

PDB Description: Crystal structure of interacting Clostridium thermocellum multimodular components

PDB Compounds: (B:) Cellulosome anchoring protein, cohesin region

SCOPe Domain Sequences for d3kcpb_:

Sequence; same for both SEQRES and ATOM records:

>d3kcpb_ b.2.2.2 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
ssielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsstf
ppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkilq
kkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvls

Timeline for d3kcpb_:

• d3kcpb_ is new in SCOPe 2.01-stable
  
• d3kcpb_ appears in SCOPe 2.02
  
• d3kcpb_ appears in the current release, SCOPe 2.08