Lineage for d3kcpb_ (3kcp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767323Protein automated matches [190248] (6 species)
    not a true protein
  7. 2767340Species Clostridium thermocellum [TaxId:203119] [189219] (2 PDB entries)
  8. 2767342Domain d3kcpb_: 3kcp B: [179274]
    automated match to d2b59a1
    complexed with ca, cl

Details for d3kcpb_

PDB Entry: 3kcp (more details), 1.94 Å

PDB Description: Crystal structure of interacting Clostridium thermocellum multimodular components
PDB Compounds: (B:) Cellulosome anchoring protein, cohesin region

SCOPe Domain Sequences for d3kcpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcpb_ b.2.2.2 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
ssielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsstf
ppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkilq
kkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvls

SCOPe Domain Coordinates for d3kcpb_:

Click to download the PDB-style file with coordinates for d3kcpb_.
(The format of our PDB-style files is described here.)

Timeline for d3kcpb_: