SCOPe 2.01: Domain d3kchc_: 3kch C:

Lineage for d3kchc_ (3kch C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (45 PDB entries)

8. Domain d3kchc_: 3kch C: [179270]
   automated match to d1b27a_
   complexed with ptd

Details for d3kchc_

PDB Entry: 3kch, 1.94 Å

PDB Description: Baranase crosslinked by glutaraldehyde

PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d3kchc_:

Sequence; same for both SEQRES and ATOM records:

>d3kchc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d3kchc_:

• d3kchc_ is new in SCOPe 2.01-stable
  
• d3kchc_ appears in SCOPe 2.02
  
• d3kchc_ appears in the current release, SCOPe 2.08