Lineage for d1bg8c_ (1bg8 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001044Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
    4 helices; the three last helices form a bundle similar to that of the RuvA C-domain
  4. 2001045Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) (S)
    overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
    automatically mapped to Pfam PF06411
  5. 2001046Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins)
  6. 2001047Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
    periplasmic protein that supports acid resistance in enteric bacteria
  7. 2001048Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)
  8. 2001057Domain d1bg8c_: 1bg8 C: [17927]
    CASP3

Details for d1bg8c_

PDB Entry: 1bg8 (more details), 2.2 Å

PDB Description: hdea from escherichia coli
PDB Compounds: (C:) hdea

SCOPe Domain Sequences for d1bg8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg8c_ a.57.1.1 (C:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
kkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactqd
kqanfkdkvkgewdki

SCOPe Domain Coordinates for d1bg8c_:

Click to download the PDB-style file with coordinates for d1bg8c_.
(The format of our PDB-style files is described here.)

Timeline for d1bg8c_: