![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily) 4 helices; the three last helices form a bundle similar to that of the RuvA C-domain |
![]() | Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) ![]() overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN) automatically mapped to Pfam PF06411 |
![]() | Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins) |
![]() | Protein Protein HNS-dependent expression A; HdeA [47754] (1 species) periplasmic protein that supports acid resistance in enteric bacteria |
![]() | Species Escherichia coli [TaxId:562] [47755] (2 PDB entries) |
![]() | Domain d1bg8c_: 1bg8 C: [17927] CASP3 |
PDB Entry: 1bg8 (more details), 2.2 Å
SCOPe Domain Sequences for d1bg8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg8c_ a.57.1.1 (C:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]} kkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactqd kqanfkdkvkgewdki
Timeline for d1bg8c_: