SCOPe 2.05: Domain d3kcha_: 3kch A:

Lineage for d3kcha_ (3kch A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Barnase [81305] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)

8. Domain d3kcha_: 3kch A: [179268]
   automated match to d1b27a_
   complexed with ptd

Details for d3kcha_

PDB Entry: 3kch, 1.94 Å

PDB Description: Baranase crosslinked by glutaraldehyde

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d3kcha_:

Sequence; same for both SEQRES and ATOM records:

>d3kcha_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

Timeline for d3kcha_:

• d3kcha_ first appeared in SCOPe 2.01
  
• d3kcha_ appears in SCOPe 2.04
  
• d3kcha_ appears in SCOPe 2.06
  
• d3kcha_ appears in the current release, SCOPe 2.08