![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Factor IX (IXa) [57198] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57199] (17 PDB entries) |
![]() | Domain d3kcgl_: 3kcg L: [179267] Other proteins in same PDB: d3kcgh_, d3kcgi_ automated match to d1rfnb_ complexed with ca, mpd, ntp |
PDB Entry: 3kcg (more details), 1.7 Å
SCOPe Domain Sequences for d3kcgl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcgl_ g.3.11.1 (L:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} mdvtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsv
Timeline for d3kcgl_: