Lineage for d3kcgl_ (3kcg L:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031327Protein Factor IX (IXa) [57198] (2 species)
  7. 3031328Species Human (Homo sapiens) [TaxId:9606] [57199] (33 PDB entries)
  8. 3031339Domain d3kcgl_: 3kcg L: [179267]
    Other proteins in same PDB: d3kcgh_, d3kcgi_
    automated match to d1rfnb_
    complexed with ca, mpd

Details for d3kcgl_

PDB Entry: 3kcg (more details), 1.7 Å

PDB Description: crystal structure of the antithrombin-factor ixa-pentasaccharide complex
PDB Compounds: (L:) Coagulation factor IXa light chain

SCOPe Domain Sequences for d3kcgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcgl_ g.3.11.1 (L:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
mdvtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsv

SCOPe Domain Coordinates for d3kcgl_:

Click to download the PDB-style file with coordinates for d3kcgl_.
(The format of our PDB-style files is described here.)

Timeline for d3kcgl_: