SCOPe 2.02: Domain d3kcfc_: 3kcf C:

Lineage for d3kcfc_ (3kcf C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d3kcfc_: 3kcf C: [179262]
   automated match to d1iasb_
   complexed with jzo, po4

Details for d3kcfc_

PDB Entry: 3kcf, 2.8 Å

PDB Description: Crystal structure of TGFbRI complexed with a pyrazolone inhibitor

PDB Compounds: (C:) TGF-beta receptor type-1

SCOPe Domain Sequences for d3kcfc_:

Sequence; same for both SEQRES and ATOM records:

>d3kcfc_ d.144.1.7 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
mrecwyangaarltalrikktlsqlsqqeg

Timeline for d3kcfc_:

• d3kcfc_ first appeared in SCOPe 2.01
  
• d3kcfc_ appears in SCOPe 2.03
  
• d3kcfc_ appears in the current release, SCOPe 2.08