| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily) 4 helices; the three last helices form a bundle similar to that of the RuvA C-domain |
Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) ![]() overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN) automatically mapped to Pfam PF06411 |
| Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins) |
| Protein Protein HNS-dependent expression A; HdeA [47754] (1 species) periplasmic protein that supports acid resistance in enteric bacteria |
| Species Escherichia coli [TaxId:562] [47755] (2 PDB entries) |
| Domain d1bg8b_: 1bg8 B: [17926] CASP3 |
PDB Entry: 1bg8 (more details), 2.2 Å
SCOPe Domain Sequences for d1bg8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg8b_ a.57.1.1 (B:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
kkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactqd
kqanfkdkvkgewdki
Timeline for d1bg8b_: