Lineage for d1bg8a_ (1bg8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328518Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
    4 helices; the three last helices form a bundle similar to that of the RuvA C-domain
  4. 2328519Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) (S)
    overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
    automatically mapped to Pfam PF06411
  5. 2328520Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins)
  6. 2328521Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
    periplasmic protein that supports acid resistance in enteric bacteria
  7. 2328522Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)
  8. 2328529Domain d1bg8a_: 1bg8 A: [17925]
    CASP3

Details for d1bg8a_

PDB Entry: 1bg8 (more details), 2.2 Å

PDB Description: hdea from escherichia coli
PDB Compounds: (A:) hdea

SCOPe Domain Sequences for d1bg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg8a_ a.57.1.1 (A:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
kkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactqd
kqanfkdkvkgewdki

SCOPe Domain Coordinates for d1bg8a_:

Click to download the PDB-style file with coordinates for d1bg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bg8a_: