SCOPe 2.06: Domain d1dj8f_: 1dj8 F:

Lineage for d1dj8f_ (1dj8 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
   4 helices; the three last helices form a bundle similar to that of the RuvA C-domain

4. Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family)
   overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
   automatically mapped to Pfam PF06411

5. Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins)

6. Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
   periplasmic protein that supports acid resistance in enteric bacteria

7. Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)

8. Domain d1dj8f_: 1dj8 F: [17924]

Details for d1dj8f_

PDB Entry: 1dj8, 2 Å

PDB Description: crystal structure of e. coli periplasmic protein hdea

PDB Compounds: (F:) protein hns-dependent expression a

SCOPe Domain Sequences for d1dj8f_:

Sequence; same for both SEQRES and ATOM records:

>d1dj8f_ a.57.1.1 (F:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq
dkqanfkdkvkgewdkikk

Timeline for d1dj8f_:

• d1dj8f_ first appeared (with stable ids) in SCOP 1.55
  
• d1dj8f_ appears in SCOPe 2.05
  
• d1dj8f_ appears in SCOPe 2.07
  
• d1dj8f_ appears in the current release, SCOPe 2.08