Lineage for d3kbea_ (3kbe A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031512Protein automated matches [190916] (10 species)
    not a true protein
  7. 2031523Species Nematode (Caenorhabditis elegans) [TaxId:6239] [189491] (2 PDB entries)
  8. 2031524Domain d3kbea_: 3kbe A: [179233]
    automated match to d1b4la_

Details for d3kbea_

PDB Entry: 3kbe (more details), 1.1 Å

PDB Description: Metal-free C. elegans Cu,Zn Superoxide Dismutase
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3kbea_:

Sequence, based on SEQRES records: (download)

>d3kbea_ b.1.8.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
snravavlrgetvtgtiwitqksendqaviegeikgltpglhgfhvhqygdstngcisag
phfnpfgkthggpkseirhvgdlgnveagadgvakikltdtlvtlygpntvvgrsmvvha
gqddlgegvgdkaeeskktgnagaraacgvialaapq

Sequence, based on observed residues (ATOM records): (download)

>d3kbea_ b.1.8.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
snravavlrgetvtgtiwitqksendqaviegeikgltpglhgfhvhqygdstngcisag
phfnpfgkthggpkseirhvgdlgnveagadgvakikltdtlvtlygpntvvgrsmvvha
gtgnagaraacgvialaapq

SCOPe Domain Coordinates for d3kbea_:

Click to download the PDB-style file with coordinates for d3kbea_.
(The format of our PDB-style files is described here.)

Timeline for d3kbea_: