Lineage for d3kb2b_ (3kb2 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845581Protein automated matches [190087] (8 species)
    not a true protein
  7. 1845582Species Bacillus subtilis [TaxId:1423] [189093] (1 PDB entry)
  8. 1845584Domain d3kb2b_: 3kb2 B: [179230]
    automated match to d2axpa1
    complexed with g3d, mg

Details for d3kb2b_

PDB Entry: 3kb2 (more details), 2.2 Å

PDB Description: crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
PDB Compounds: (B:) SPBc2 prophage-derived uncharacterized protein yorR

SCOPe Domain Sequences for d3kb2b_:

Sequence, based on SEQRES records: (download)

>d3kb2b_ c.37.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhh

Sequence, based on observed residues (ATOM records): (download)

>d3kb2b_ c.37.1.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeydi
dsilelyrevmsnaglhtyswdtgqwssdeiakdiiflvelehhhhh

SCOPe Domain Coordinates for d3kb2b_:

Click to download the PDB-style file with coordinates for d3kb2b_.
(The format of our PDB-style files is described here.)

Timeline for d3kb2b_: