Lineage for d3kb2b1 (3kb2 B:2-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866234Species Bacillus subtilis [TaxId:1423] [189093] (1 PDB entry)
  8. 2866236Domain d3kb2b1: 3kb2 B:2-165 [179230]
    Other proteins in same PDB: d3kb2a2, d3kb2b2
    automated match to d2axpa1
    complexed with g3d, mg

Details for d3kb2b1

PDB Entry: 3kb2 (more details), 2.2 Å

PDB Description: crystal structure of yorr protein in complex with phosphorylated gdp from bacillus subtilis, northeast structural genomics consortium target sr256
PDB Compounds: (B:) SPBc2 prophage-derived uncharacterized protein yorR

SCOPe Domain Sequences for d3kb2b1:

Sequence, based on SEQRES records: (download)

>d3kb2b1 c.37.1.1 (B:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeyie
gkdidsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve

Sequence, based on observed residues (ATOM records): (download)

>d3kb2b1 c.37.1.1 (B:2-165) automated matches {Bacillus subtilis [TaxId: 1423]}
tliilegpdccfkstvaaklskelkypiikgssfelaksgneklfehfnkladednviid
rfvysnlvyakkfkdysilterqlrfiedkikakakvvylhadpsvikkrlrvrgdeydi
dsilelyrevmsnaglhtyswdtgqwssdeiakdiiflve

SCOPe Domain Coordinates for d3kb2b1:

Click to download the PDB-style file with coordinates for d3kb2b1.
(The format of our PDB-style files is described here.)

Timeline for d3kb2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kb2b2