Class a: All alpha proteins [46456] (289 folds) |
Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily) 4 helices; the three last helices form a bundle similar to that of the RuvA C-domain |
Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN) automatically mapped to Pfam PF06411 |
Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins) |
Protein Protein HNS-dependent expression A; HdeA [47754] (1 species) periplasmic protein that supports acid resistance in enteric bacteria |
Species Escherichia coli [TaxId:562] [47755] (2 PDB entries) |
Domain d1dj8e_: 1dj8 E: [17923] |
PDB Entry: 1dj8 (more details), 2 Å
SCOPe Domain Sequences for d1dj8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dj8e_ a.57.1.1 (E:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]} nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq dkqanfkdkvkgewdkikk
Timeline for d1dj8e_: