Lineage for d1dj8e_ (1dj8 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001044Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
    4 helices; the three last helices form a bundle similar to that of the RuvA C-domain
  4. 2001045Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) (S)
    overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
    automatically mapped to Pfam PF06411
  5. 2001046Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins)
  6. 2001047Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
    periplasmic protein that supports acid resistance in enteric bacteria
  7. 2001048Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)
  8. 2001053Domain d1dj8e_: 1dj8 E: [17923]

Details for d1dj8e_

PDB Entry: 1dj8 (more details), 2 Å

PDB Description: crystal structure of e. coli periplasmic protein hdea
PDB Compounds: (E:) protein hns-dependent expression a

SCOPe Domain Sequences for d1dj8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj8e_ a.57.1.1 (E:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq
dkqanfkdkvkgewdkikk

SCOPe Domain Coordinates for d1dj8e_:

Click to download the PDB-style file with coordinates for d1dj8e_.
(The format of our PDB-style files is described here.)

Timeline for d1dj8e_: