| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
| Domain d3ka3a_: 3ka3 A: [179219] automated match to d1mfra_ complexed with cl, mg |
PDB Entry: 3ka3 (more details), 1.4 Å
SCOPe Domain Sequences for d3ka3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ka3a_ a.25.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes
Timeline for d3ka3a_: