Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (30 species) not a true protein |
Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (4 PDB entries) |
Domain d3k9za_: 3k9z A: [179218] automated match to d104ma_ complexed with fe2, hem |
PDB Entry: 3k9z (more details), 1.72 Å
SCOPe Domain Sequences for d3k9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9za_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d3k9za_: