Lineage for d3k9lc_ (3k9l C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866833Protein cH-p21 Ras protein [52593] (1 species)
  7. 2866834Species Human (Homo sapiens) [TaxId:9606] [52594] (160 PDB entries)
    Uniprot Q6P716
  8. 2866893Domain d3k9lc_: 3k9l C: [179213]
    automated match to d1aa9a_
    complexed with ca, gnp, mg

Details for d3k9lc_

PDB Entry: 3k9l (more details), 1.8 Å

PDB Description: allosteric modulation of h-ras gtpase
PDB Compounds: (C:) gtpase hras

SCOPe Domain Sequences for d3k9lc_:

Sequence, based on SEQRES records: (download)

>d3k9lc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records): (download)

>d3k9lc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdefdptiedsyrkqvvidgetclldildtag
dqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesr
qaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d3k9lc_:

Click to download the PDB-style file with coordinates for d3k9lc_.
(The format of our PDB-style files is described here.)

Timeline for d3k9lc_: