SCOPe 2.05: Domain d1dj8c_: 1dj8 C:

Lineage for d1dj8c_ (1dj8 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
   4 helices; the three last helices form a bundle similar to that of the RuvA C-domain

4. Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family)
   overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
   automatically mapped to Pfam PF06411

5. Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (1 protein)

6. Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
   periplasmic protein that supports acid resistance in enteric bacteria

7. Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)

8. Domain d1dj8c_: 1dj8 C: [17921]

Details for d1dj8c_

PDB Entry: 1dj8, 2 Å

PDB Description: crystal structure of e. coli periplasmic protein hdea

PDB Compounds: (C:) protein hns-dependent expression a

SCOPe Domain Sequences for d1dj8c_:

Sequence; same for both SEQRES and ATOM records:

>d1dj8c_ a.57.1.1 (C:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq
dkqanfkdkvkgewdkikk

Timeline for d1dj8c_:

• d1dj8c_ first appeared (with stable ids) in SCOP 1.55
  
• d1dj8c_ appears in SCOPe 2.04
  
• d1dj8c_ appears in SCOPe 2.06
  
• d1dj8c_ appears in the current release, SCOPe 2.08