Lineage for d1dj8c_ (1dj8 C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4234Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
  4. 4235Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) (S)
  5. 4236Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (1 protein)
  6. 4237Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
  7. 4238Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)
  8. 4241Domain d1dj8c_: 1dj8 C: [17921]

Details for d1dj8c_

PDB Entry: 1dj8 (more details), 2 Å

PDB Description: crystal structure of e. coli periplasmic protein hdea

SCOP Domain Sequences for d1dj8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj8c_ a.57.1.1 (C:) Protein HNS-dependent expression A; HdeA {Escherichia coli}
nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq
dkqanfkdkvkgewdkikk

SCOP Domain Coordinates for d1dj8c_:

Click to download the PDB-style file with coordinates for d1dj8c_.
(The format of our PDB-style files is described here.)

Timeline for d1dj8c_: