Lineage for d3k9ea_ (3k9e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137788Species Escherichia coli [TaxId:217992] [189024] (2 PDB entries)
  8. 2137791Domain d3k9ea_: 3k9e A: [179209]
    Other proteins in same PDB: d3k9eb2
    automated match to d1wyea1

Details for d3k9ea_

PDB Entry: 3k9e (more details), 2.05 Å

PDB Description: Crystal structure of a putative Ribokinase II (Apo Form) from E.coli
PDB Compounds: (A:) putative Ribokinase II

SCOPe Domain Sequences for d3k9ea_:

Sequence, based on SEQRES records: (download)

>d3k9ea_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}
skvftigeilveimaskigqpfdqpgiwngpypsgapaifidqvtrlgvpcgiiscvgnd
gfgdinihrlaadgvdirgisvlpleatgsafvtyhnsgdrdfifniknaacgklsaqhv
denilkdcthfhimgsslfsfhmvdavkkavtivkanggvisfdpnirkemldipemrda
lhfvleltdiympsegevlllsphstperaiagfleegvkevivkrgnqgasyysaneqf
hvesypveevdptgagdcfggawiacrqlgfdahralqyanacgalavtrrgpmegtsrl
meietfiqrh

Sequence, based on observed residues (ATOM records): (download)

>d3k9ea_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}
skvftigeilveimaskigqpfdqpgiwngpypsgapaifidqvtrlgvpcgiiscvgnd
gfgdinihrlaadgvdirgisvlpleatgsafvtyhnrdfifniknaacgklsaqhvden
ilkdcthfhimgsslfsfhmvdavkkavtivkanggvisfdpnirkemldipemrdalhf
vleltdiympsegevlllsphstperaiagfleegvkevivkrgnqgasyysaneqfhve
sypveevdptgagdcfggawiacrqlgfdahralqyanacgalavtrrgpmegtsrlmei
etfiqrh

SCOPe Domain Coordinates for d3k9ea_:

Click to download the PDB-style file with coordinates for d3k9ea_.
(The format of our PDB-style files is described here.)

Timeline for d3k9ea_: