SCOPe 2.05: Domain d3k99b_: 3k99 B:

Lineage for d3k99b_ (3k99 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (80 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3k99b_: 3k99 B: [179206]
   automated match to d1osfa_
   complexed with pft

Details for d3k99b_

PDB Entry: 3k99, 2.1 Å

PDB Description: HSP90 N-terminal domain in complex with 4-(1,3-dihydro-2H-isoindol-2-ylcarbonyl)benzene-1,3-diol

PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3k99b_:

Sequence; same for both SEQRES and ATOM records:

>d3k99b_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl
dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
kedqteyleerrikeivkkhsqfigypitlfvekel

Timeline for d3k99b_:

• d3k99b_ first appeared in SCOPe 2.01
  
• d3k99b_ appears in SCOPe 2.04
  
• d3k99b_ is called d3k99b1 in SCOPe 2.06
  
• d3k99b_ appears in the current release, SCOPe 2.08, called d3k99b1