SCOPe 2.08: Domain d1dj8b_: 1dj8 B:

Lineage for d1dj8b_ (1dj8 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
   4 helices; the three last helices form a bundle similar to that of the RuvA C-domain

4. Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family)
   overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
   automatically mapped to Pfam PF06411

5. Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 proteins)

6. Protein Protein HNS-dependent expression A; HdeA [47754] (1 species)
   periplasmic protein that supports acid resistance in enteric bacteria

7. Species Escherichia coli [TaxId:562] [47755] (2 PDB entries)

8. Domain d1dj8b_: 1dj8 B: [17920]

Details for d1dj8b_

PDB Entry: 1dj8, 2 Å

PDB Description: crystal structure of e. coli periplasmic protein hdea

PDB Compounds: (B:) protein hns-dependent expression a

SCOPe Domain Sequences for d1dj8b_:

Sequence; same for both SEQRES and ATOM records:

>d1dj8b_ a.57.1.1 (B:) Protein HNS-dependent expression A; HdeA {Escherichia coli [TaxId: 562]}
nkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtpaivqactq
dkqanfkdkvkgewdkikk

Timeline for d1dj8b_:

• d1dj8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dj8b_ appears in SCOPe 2.07