Lineage for d3k8qa_ (3k8q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2888150Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries)
    Uniprot P00491
  8. 2888177Domain d3k8qa_: 3k8q A: [179197]
    automated match to d1ulaa_
    complexed with 22a, po4

Details for d3k8qa_

PDB Entry: 3k8q (more details), 2.5 Å

PDB Description: crystal structure of human purine nucleoside phosphorylase in complex with serme-immucillin h
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3k8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k8qa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpd

SCOPe Domain Coordinates for d3k8qa_:

Click to download the PDB-style file with coordinates for d3k8qa_.
(The format of our PDB-style files is described here.)

Timeline for d3k8qa_: