Lineage for d3k8ed_ (3k8e D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133768Protein automated matches [190992] (6 species)
    not a true protein
  7. 2133769Species Escherichia coli K-12 [TaxId:83333] [189105] (2 PDB entries)
  8. 2133775Domain d3k8ed_: 3k8e D: [179190]
    automated match to d1vh1a_

Details for d3k8ed_

PDB Entry: 3k8e (more details), 2.51 Å

PDB Description: Crystal structure of E. coli lipopolysaccharide specific CMP-KDO synthetase
PDB Compounds: (D:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3k8ed_:

Sequence, based on SEQRES records: (download)

>d3k8ed_ c.68.1.13 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaag
gevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvg
matlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrhl
giygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedler
vraem

Sequence, based on observed residues (ATOM records): (download)

>d3k8ed_ c.68.1.13 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
fvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaag
gevcmtrsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqvgmatl
avpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegvgdnflrhlgiygyra
gfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedlervraem

SCOPe Domain Coordinates for d3k8ed_:

Click to download the PDB-style file with coordinates for d3k8ed_.
(The format of our PDB-style files is described here.)

Timeline for d3k8ed_: