Lineage for d3k8ec_ (3k8e C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002257Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 1002338Protein automated matches [190992] (5 species)
    not a true protein
  7. 1002339Species Escherichia coli K-12 [TaxId:83333] [189105] (2 PDB entries)
  8. 1002344Domain d3k8ec_: 3k8e C: [179189]
    automated match to d1vh1a_

Details for d3k8ec_

PDB Entry: 3k8e (more details), 2.51 Å

PDB Description: Crystal structure of E. coli lipopolysaccharide specific CMP-KDO synthetase
PDB Compounds: (C:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3k8ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k8ec_ c.68.1.13 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa
ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv
gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrh
lgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedle
rvra

SCOPe Domain Coordinates for d3k8ec_:

Click to download the PDB-style file with coordinates for d3k8ec_.
(The format of our PDB-style files is described here.)

Timeline for d3k8ec_: