Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein automated matches [190992] (6 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189105] (2 PDB entries) |
Domain d3k8ea_: 3k8e A: [179187] automated match to d1vh1a_ |
PDB Entry: 3k8e (more details), 2.51 Å
SCOPe Domain Sequences for d3k8ea_:
Sequence, based on SEQRES records: (download)
>d3k8ea_ c.68.1.13 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegletvgdnflrh lgiygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedle rvrae
>d3k8ea_ c.68.1.13 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} sfvviiparyastrlpgkplvdingkpmivhvleraresgaeriivatdhedvaraveaa ggevcmtradhqsgterlaevvekcafsddtvivnvqgdepmipatiirqvadnlaqrqv gmatlavpihnaeeafnpnavkvvldaegyalyfsratipwdrdrfaegvgdnflrhlgi ygyragfirryvnwqpsplehiemleqlrvlwygekihvavaqevpgtgvdtpedlervr ae
Timeline for d3k8ea_: