SCOPe 2.02: Domain d3k80b_: 3k80 B:

Lineage for d3k80b_ (3k80 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (15 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (23 PDB entries)

8. Domain d3k80b_: 3k80 B: [179179]
   automated match to d1i3va_

Details for d3k80b_

PDB Entry: 3k80, 2.4 Å

PDB Description: Structure of essential protein from Trypanosoma brucei

PDB Compounds: (B:) antibody

SCOPe Domain Sequences for d3k80b_:

Sequence; same for both SEQRES and ATOM records:

>d3k80b_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqya
eslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqvt
vssh

Timeline for d3k80b_:

• d3k80b_ first appeared in SCOPe 2.01
  
• d3k80b_ appears in SCOPe 2.03
  
• d3k80b_ appears in the current release, SCOPe 2.08, called d3k80b1