Lineage for d3k80b1 (3k80 B:2-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743895Domain d3k80b1: 3k80 B:2-123 [179179]
    Other proteins in same PDB: d3k80a2, d3k80b2
    automated match to d1i3va_

Details for d3k80b1

PDB Entry: 3k80 (more details), 2.4 Å

PDB Description: Structure of essential protein from Trypanosoma brucei
PDB Compounds: (B:) antibody

SCOPe Domain Sequences for d3k80b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k80b1 b.1.1.1 (B:2-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqagdslrlscvasgrafssygmgwfrqapgkerafvaaisrsggltqya
eslkgrfaisrdnakntvylqmgslkpedtavyycagdlyglgshmeneydswgqgtqvt
vs

SCOPe Domain Coordinates for d3k80b1:

Click to download the PDB-style file with coordinates for d3k80b1.
(The format of our PDB-style files is described here.)

Timeline for d3k80b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k80b2