Lineage for d3k7zb_ (3k7z B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039540Protein GCN4 [57961] (2 species)
  7. 3039541Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 3039683Domain d3k7zb_: 3k7z B: [179176]
    trimeric mutant
    mutant

Details for d3k7zb_

PDB Entry: 3k7z (more details), 1.9 Å

PDB Description: gcn4-leucine zipper core mutant as n16a trigonal automatic solution
PDB Compounds: (B:) General control protein GCN4

SCOPe Domain Sequences for d3k7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7zb_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellskayhlenevarlkklvg

SCOPe Domain Coordinates for d3k7zb_:

Click to download the PDB-style file with coordinates for d3k7zb_.
(The format of our PDB-style files is described here.)

Timeline for d3k7zb_: