Lineage for d3k7ya_ (3k7y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132789Species Plasmodium falciparum [TaxId:36329] [189486] (2 PDB entries)
  8. 2132790Domain d3k7ya_: 3k7y A: [179174]
    automated match to d1amaa_
    complexed with act, plp

Details for d3k7ya_

PDB Entry: 3k7y (more details), 2.8 Å

PDB Description: Aspartate Aminotransferase of Plasmodium falciparum
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d3k7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7ya_ c.67.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mdkllsslenievdnilktarefkedtceekinlsigvccnddgdlhifdsvlnadklvt
enykekpyllgngtedfstltqnlifgnnskyiedkkictiqciggtgaifvlleflkml
nvetlyvtnppyinhvnmiesrgfnlkyinffdynlidinydlflndlrnipngssvilq
iscynpcsvnieekyfdeiieivlhkkhviifdiayqgfghtnleedvllirkfeeknia
fsvcqsfsknmslygeragalhivcknqeekkivfnnlcfivrkfysspvihtnrilcql
lnnqnlklnwikelsqlsqritnnrilffnkletyqkkynlnydwnvykkqrglfsfvpl
lakiaehlkthhiyiinngrinvsgitknnvdyiadkiclslsqi

SCOPe Domain Coordinates for d3k7ya_:

Click to download the PDB-style file with coordinates for d3k7ya_.
(The format of our PDB-style files is described here.)

Timeline for d3k7ya_: