SCOPe 2.04: Domain d1ffua1: 1ffu A:82-157

Lineage for d1ffua1 (1ffu A:82-157)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)

8. Domain d1ffua1: 1ffu A:82-157 [17917]
   Other proteins in same PDB: d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud2, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2
   complexed with cdp, fad, fes

Details for d1ffua1

PDB Entry: 1ffu, 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

PDB Compounds: (A:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffua1:

Sequence; same for both SEQRES and ATOM records:

>d1ffua1 a.56.1.1 (A:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

Timeline for d1ffua1:

• d1ffua1 first appeared (with stable ids) in SCOP 1.55
  
• d1ffua1 appears in SCOPe 2.03
  
• d1ffua1 appears in SCOPe 2.05
  
• d1ffua1 appears in the current release, SCOPe 2.08