SCOPe 2.04: Domain d3k7ua_: 3k7u A:

Lineage for d3k7ua_ (3k7u A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d3k7ua_: 3k7u A: [179169]
   automated match to d1qd0a_

Details for d3k7ua_

PDB Entry: 3k7u, 2.1 Å

PDB Description: Structure of essential protein from Trypanosoma brucei

PDB Compounds: (A:) antibody

SCOPe Domain Sequences for d3k7ua_:

Sequence; same for both SEQRES and ATOM records:

>d3k7ua_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggsltlscaasgrtfsnnamgwfrqapgkerefvaaiswtggllfyad
svngrftisrdnakrtvtlqmnslkpedtavyycaarpqgdyvtahydywgqgtqvtvs

Timeline for d3k7ua_:

• d3k7ua_ first appeared in SCOPe 2.01
  
• d3k7ua_ appears in SCOPe 2.03
  
• d3k7ua_ appears in SCOPe 2.05
  
• d3k7ua_ appears in the current release, SCOPe 2.08, called d3k7ua1